PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR07G03250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family YABBY
Protein Properties Length: 133aa    MW: 14933.9 Da    PI: 8.6141
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR07G03250.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY91.81.7e-28263263
            YABBY  2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshl 63
                     + +++se+vCyv+Cn+Cntil+v+vP+++++++vtvrCGhCt++ls++la ++q++++++h 
  LPERR07G03250.1  2 SAQFTSEHVCYVNCNYCNTILVVNVPNNCSYNIVTVRCGHCTMVLSMDLAPFHQARTVQDHQ 63
                     6789*******************************************************993 PP

2YABBY118.41.2e-3669123116170
            YABBY 116 irPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                       + PekrqrvPsaynrfikeeiqrik+snP+ishreafsaaaknWah+P++hfgl
  LPERR07G03250.1  69 FQAPEKRQRVPSAYNRFIKEEIQRIKTSNPEISHREAFSAAAKNWAHLPRLHFGL 123
                      568**************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046904.5E-20664IPR006780YABBY protein
PfamPF046905.1E-3465123IPR006780YABBY protein
SuperFamilySSF470951.83E-866117IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.104.1E-670117IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048833Biological Processspecification of floral organ number
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MSAQFTSEHV CYVNCNYCNT ILVVNVPNNC SYNIVTVRCG HCTMVLSMDL APFHQARTVQ  60
DHQVQNRGFQ APEKRQRVPS AYNRFIKEEI QRIKTSNPEI SHREAFSAAA KNWAHLPRLH  120
FGLSVADGGG GSN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2740136e-95AB274013.1 Oryza sativa Japonica Group OsYABBY1 mRNA for OsYABBY1 protein, complete cds.
GenBankAF0987526e-95AF098752.1 Oryza sativa clone FIL1 unknown mRNA.
GenBankAK0700456e-95AK070045.1 Oryza sativa Japonica Group cDNA clone:J023038F18, full insert sequence.
GenBankCT8286816e-95CT828681.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA230C13, full insert sequence.
GenBankCT8286826e-95CT828682.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA240F12, full insert sequence.
GenBankCT8286836e-95CT828683.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA249C03, full insert sequence.
GenBankCT8286846e-95CT828684.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN084I04, full insert sequence.
GenBankCT8325776e-95CT832577.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA333Z37, full insert sequence.
GenBankFJ7509326e-95FJ750932.1 Oryza sativa clone KCS005G02 MADS-box transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006657460.19e-87PREDICTED: protein YABBY 1
SwissprotQ7XIM72e-86YAB1_ORYSJ; Protein YABBY 1
TrEMBLA0A0D9WVP66e-98A0A0D9WVP6_9ORYZ; Uncharacterized protein
STRINGOB07G12810.13e-86(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP139437121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08465.14e-48YABBY family protein